1. Notes: 614 / 4 months ago  from deliciousanddecadence (originally from filthywetslut)
    filthywetslut:

I love wrapping my hands around his balls while he slides his thick cock into my pussy. Sometimes when it get’s really good, and really rough, I dig my nails in a little. It’s the perfect touch.

    filthywetslut:

    I love wrapping my hands around his balls while he slides his thick cock into my pussy. Sometimes when it get’s really good, and really rough, I dig my nails in a little. It’s the perfect touch.

     
  2. Notes: 38 / 4 months ago  from deliciousanddecadence (originally from bubbleback)
    bubbleback:

“Fill ‘er up”

    bubbleback:

    “Fill ‘er up”

     
  3. Notes: 1765 / 4 months ago  from roguek9 (originally from adirtyfantasy-deactivated201202)
    fortyluscious:

hotcrazycouple:

making her scream is a must -him

-He

    fortyluscious:

    hotcrazycouple:

    making her scream is a must -him

    -He

    (Source: adirtyfantasy)

     
  4. Notes: 1854 / 4 months ago  from roguek9 (originally from whitneyisagoodtime)
    If I had a Mistress…

    If I had a Mistress…

    (Source: whitneyisagoodtime)

     
  5. Notes: 2614 / 4 months ago  from roguek9 (originally from 2drool4)
    I want this.
roguek9:

herestoohot:

rough.

Take that.

    I want this.

    roguek9:

    herestoohot:

    rough.

    Take that.

    (Source: 2drool4)

     
  6. Notes: 1810 / 4 months ago  from acquiescentsecrets (originally from thebadboys)

    (Source: thebadboys)

     
  7. Notes: 89 / 4 months ago  from rideofalifetime69 (originally from m-n-mj)
    fuckmeimwet:

http://fuckmeimwet.tumblr.com/
     
  8. Notes: 33 / 4 months ago  from roguek9 (originally from slutsndrugs-deactivated20120401)
    I really want one of these.

    I really want one of these.

     
  9. 5 months ago 

    domsimon asked: Submission....will it be only a dream for you?thx for following...

    Most likely yes, it will only be a dream for me as I don’t have the courage to take it further. Still a new year brings about new opportunities, so maybe that will change.

  10. Notes: 67 / 7 months ago  from deliciousanddecadence (originally from justemanuell)

    (Source: justemanuell)

     
avatar_128
 
 
The Girl

i have many names, depending on who you are speaking to and to protect my anonymity, i will tell you that my name is SG. i am a 23 year old woman living in the South East of England, with many aspirations and if i am to praise myself, a few talents too. i have an eclectic taste in music, anything from 60’s to the naughties (yes, that was a deliberate misspelling), dance, trance, techno, R&B, i really do listen to anything. i read a lot too, from Harry Potter to historical novels, my eclectic tastes travel to every aspect of my life but we’ll touch more on that later.

The Dream

This is really quite simple, the dream is to submit, to find myself a good Dominant and gift him with my mind and body. While i will post images of submission and sometimes even my own writing of my thoughts on Dominance and submission, that’s exactly what it is, my thoughts. In my opinion, there is no right or wrong way to submit, so i apologise if anyone disagrees with anything that i say here but it is simply, my thoughts and my feelings. At no point will i ever say that it is the right way.

Disclaimer

The images I post here have been collected from the internet and are presumed to be in the public domain and free for use, unless I have otherwise stated. If however, there is a wish for any of these images to be removed, please inform me and I will do so.

  • Ask Me Anything


  • My Pages

  • A submissive Musings Page
  •  
     

    Following

    kindlybeatingherdarkthoughtsdarkdeedsdaddyssweetslavespankingmaster69sirmountalota-kinksters-blogrideofalifetime69hisdirtylittlegirlbunnybldbunchesalexandhissubmissivepetlustygentlemanmyprettylittleonefirecrackeralidvsarousaldomsimondeliciousanddecadencecatastrophia49the-shibari-schoolsexylawdogdeepestdesireslizzysplaceiheartthedoctorcorporatefuckofficerhissexynelsweetlittleslutacquiescentsecretsbullnbabedirtylittlesecret23masterandslavethisismylittlesecretmistress-belleeasilyerectedmynameismasterroguek9stuckinthedesertsexyporngifsicompeluiflookscouldreallykill13hisfavoritebitchsubmissiveonededicateddevotionnaughtyforyouaccordingtoajshysubmissivemakecassandrawetstaffs-bullintuneforhimpu33ylordrpalbert52
     

    Tumblr