1. Notes: 1012 / 1 year ago 
     
  2. Notes

    1. truelovealwayshurts reblogged this from blondeandblueeyes
    2. silentobserver33 reblogged this from teasing-n-pleasing
    3. blondeandblueeyes reblogged this from my-dirty-side
    4. vavoss reblogged this from teasing-n-pleasing
    5. njhphf2012 reblogged this from eroticimages
    6. styleerotica reblogged this from tobesubmissive
    7. f-o-r-e-v-e-r--horny reblogged this from o-r-g-a-s-m-i-cc
    8. my-dirty-side reblogged this from boba-fetttish
    9. boba-fetttish reblogged this from bizarre-bazaar
    10. firstnorthernlights reblogged this from tasty-disaster and added:
      Sit still, babygirl.
    11. tasty-disaster reblogged this from submissive-gal
    12. louisbunuel reblogged this from bella7
    13. cyther0mania reblogged this from mysexywetworld
    14. babyitsasin reblogged this from submissive-gal
    15. bigharted reblogged this from kissmyspine
    16. honeyfruity reblogged this from hislittlewhore
    17. justroo reblogged this from boobs95
    18. completami reblogged this from bizarre-bazaar
    19. fapras reblogged this from daddys-good-little-girl
    20. daddys-good-little-girl reblogged this from deardaddylovebabygirl
    21. all-inyour-head reblogged this from psychologist-in-training
    22. corvus-lapetitemort reblogged this from myownpersonaluniverse
    23. myownpersonaluniverse reblogged this from bizarre-bazaar
    24. thesalaciousstranger reblogged this from shatteredtoy
    25. tarasmaster reblogged this from aboutlosingcontrol
    26. aboutlosingcontrol reblogged this from desiretobeowned
    27. shatteredtoy reblogged this from firstnorthernlights
    28. perversonality reblogged this from dontfollowmeimlosttoo
    29. sonlycou reblogged this from bizarre-bazaar
    30. my-wife-briefcase reblogged this from myfantasiesandfetishes
    31. myfantasiesandfetishes reblogged this from teasing-n-pleasing
    32. dontfollowmeimlosttoo reblogged this from bella7
    33. fagg0t-bag reblogged this from toyieldandsubmit
    34. danielcastanon43 reblogged this from teasing-n-pleasing
    35. madandkink reblogged this from secretdaddy
avatar_128
 
 
The Girl

i have many names, depending on who you are speaking to and to protect my anonymity, i will tell you that my name is SG. i am a 23 year old woman living in the South East of England, with many aspirations and if i am to praise myself, a few talents too. i have an eclectic taste in music, anything from 60’s to the naughties (yes, that was a deliberate misspelling), dance, trance, techno, R&B, i really do listen to anything. i read a lot too, from Harry Potter to historical novels, my eclectic tastes travel to every aspect of my life but we’ll touch more on that later.

The Dream

This is really quite simple, the dream is to submit, to find myself a good Dominant and gift him with my mind and body. While i will post images of submission and sometimes even my own writing of my thoughts on Dominance and submission, that’s exactly what it is, my thoughts. In my opinion, there is no right or wrong way to submit, so i apologise if anyone disagrees with anything that i say here but it is simply, my thoughts and my feelings. At no point will i ever say that it is the right way.

Disclaimer

The images I post here have been collected from the internet and are presumed to be in the public domain and free for use, unless I have otherwise stated. If however, there is a wish for any of these images to be removed, please inform me and I will do so.

  • Ask Me Anything


  • My Pages

  • A submissive Musings Page
  •  
     

    Following

    kindlybeatingherdarkthoughtsdarkdeedsdaddyssweetslavespankingmaster69sirmountalota-kinksters-blogrideofalifetime69hisdirtylittlegirlbunnybldbunchesalexandhissubmissivepetlustygentlemanmyprettylittleonefirecrackeralidvsarousaldomsimondeliciousanddecadencecatastrophia49the-shibari-schoolsexylawdogdeepestdesireslizzysplaceiheartthedoctorcorporatefuckofficerhissexynelsweetlittleslutacquiescentsecretsbullnbabedirtylittlesecret23masterandslavethisismylittlesecretmistress-belleeasilyerectedmynameismasterroguek9stuckinthedesertsexyporngifsicompeluiflookscouldreallykill13hisfavoritebitchsubmissiveonededicateddevotionnaughtyforyouaccordingtoajshysubmissivemakecassandrawetstaffs-bullintuneforhimpu33ylordrpalbert52
     

    Tumblr